SCOPe 2.07: Domain d6qxdb_: 6qxd B:

Lineage for d6qxdb_ (6qxd B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (4 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries)

8. Domain d6qxdb_: 6qxd B: [371473]
   automated match to d4p6ra_
   complexed with cu, jkb

Details for d6qxdb_

PDB Entry: 6qxd, 2.32 Å

PDB Description: crystal structure of tyrosinase from bacillus megaterium with jkb inhibitor in the active site.

PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d6qxdb_:

Sequence; same for both SEQRES and ATOM records:

>d6qxdb_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel

Timeline for d6qxdb_:

• d6qxdb_ is new in SCOPe 2.07-stable
  
• d6qxdb_ appears in the current release, SCOPe 2.08