Lineage for d1cyqa_ (1cyq A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29757Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
  4. 29758Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) (S)
  5. 29778Family d.4.1.3: Cys-His box [54069] (1 protein)
  6. 29779Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. 29780Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (7 PDB entries)
  8. 29783Domain d1cyqa_: 1cyq A: [37147]

Details for d1cyqa_

PDB Entry: 1cyq (more details), 1.93 Å

PDB Description: intron encoded homing endonuclease i-ppoi (h98a)/dna homing site complex

SCOP Domain Sequences for d1cyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyqa_ d.4.1.3 (A:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum)}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctasalchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOP Domain Coordinates for d1cyqa_:

Click to download the PDB-style file with coordinates for d1cyqa_.
(The format of our PDB-style files is described here.)

Timeline for d1cyqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cyqb_