SCOPe 2.08: Domain d1ql0b_: 1ql0 B:

Lineage for d1ql0b_ (1ql0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.2: DNA/RNA non-specific endonuclease [54066] (2 proteins)
   the core motif is inserted in a six-stranded meander beta-sheet domain
   automatically mapped to Pfam PF01223

6. Protein Sm endonuclease [54067] (1 species)

7. Species Serratia marcescens [TaxId:615] [54068] (5 PDB entries)

8. Domain d1ql0b_: 1ql0 B: [37140]
   complexed with mg

Details for d1ql0b_

PDB Entry: 1ql0, 1.1 Å

PDB Description: sm endonuclease from seratia marcenscens at atomic resolution

PDB Compounds: (B:) Nuclease

SCOPe Domain Sequences for d1ql0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ql0b_ d.4.1.2 (B:) Sm endonuclease {Serratia marcescens [TaxId: 615]}
sidncavgcptggsskvsivrhaytlnnnsttkfanwvayhitkdtpasgktrnwktdpa
lnpadtlapadytganaalkvdrghqaplaslagvsdweslnylsnitpqksdlnqgawa
rledqerklidradissvytvtgplyerdmgklpgtqkahtipsaywkvifinnspavnh
yaaflfdqntpkgadfcqfrvtvdeiekrtgliiwaglpddvqaslkskpgvlpelmgck
n

Timeline for d1ql0b_:

• d1ql0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ql0b_ appears in SCOPe 2.07