Lineage for d6qgwb_ (6qgw B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356018Domain d6qgwb_: 6qgw B: [371369]
    automated match to d5da4a_
    complexed with c8e

Details for d6qgwb_

PDB Entry: 6qgw (more details), 1.94 Å

PDB Description: crystal structure of e.coli bama beta-barrel in complex with nanobody e6
PDB Compounds: (B:) NanoE6

SCOPe Domain Sequences for d6qgwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qgwb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qmqlvesggglvqaggsltlscaasgrtfsdydmgwfrqapgkarefvarisrsgrmtsl
adsvkgrftisrdngkrtvylqmnslkpedtavyycaadpqwsrvrsgadywgqgtrvtv
sa

SCOPe Domain Coordinates for d6qgwb_:

Click to download the PDB-style file with coordinates for d6qgwb_.
(The format of our PDB-style files is described here.)

Timeline for d6qgwb_: