Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [371346] (1 PDB entry) |
Domain d6qe8a_: 6qe8 A: [371347] automated match to d1xyna_ complexed with hzb, mes, so4 |
PDB Entry: 6qe8 (more details), 1.79 Å
SCOPe Domain Sequences for d6qe8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qe8a_ b.29.1.0 (A:) automated matches {Aspergillus niger [TaxId: 5061]} aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt iss
Timeline for d6qe8a_: