Lineage for d6qe8a_ (6qe8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390340Species Aspergillus niger [TaxId:5061] [371346] (1 PDB entry)
  8. 2390341Domain d6qe8a_: 6qe8 A: [371347]
    automated match to d1xyna_
    complexed with hzb, mes, so4

Details for d6qe8a_

PDB Entry: 6qe8 (more details), 1.79 Å

PDB Description: crystal structure of aspergillus niger gh11 endoxylanase xyna in complex with xylobiose epoxide activity based probe
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d6qe8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qe8a_ b.29.1.0 (A:) automated matches {Aspergillus niger [TaxId: 5061]}
aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
iss

SCOPe Domain Coordinates for d6qe8a_:

Click to download the PDB-style file with coordinates for d6qe8a_.
(The format of our PDB-style files is described here.)

Timeline for d6qe8a_: