SCOPe 2.08: Domain d6qgyb_: 6qgy B:

Lineage for d6qgyb_ (6qgy B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6qgyb_: 6qgy B: [371345]
   automated match to d5da4a_
   complexed with c8e

Details for d6qgyb_

PDB Entry: 6qgy, 2.51 Å

PDB Description: crystal structure of e.coli bama beta-barrel in complex with nanobody b12

PDB Compounds: (B:) NanoB12

SCOPe Domain Sequences for d6qgyb_:

Sequence; same for both SEQRES and ATOM records:

>d6qgyb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlvesgggmvqaggslrlscaasgrtfngwtaawfrqapgkdrefvaaisrsgdytyytn
svkgrftisrdsaknnlylqmdslkpedtavyycaaktgtwatmdrrydywgqgtrvtvs
a

Timeline for d6qgyb_:

• d6qgyb_ first appeared in SCOPe 2.07