Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.1: HNH-motif [54061] (2 proteins) |
Protein DNase domain of colicin E7 [54062] (1 species) |
Species Escherichia coli [TaxId:562] [54063] (8 PDB entries) |
Domain d7ceib_: 7cei B: [37134] Other proteins in same PDB: d7ceia_ complexed with zn3 |
PDB Entry: 7cei (more details), 2.3 Å
SCOP Domain Sequences for d7ceib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ceib_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp krhidih
Timeline for d7ceib_: