SCOP 1.75: Domain d7ceib_: 7cei B:

Lineage for d7ceib_ (7cei B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (2 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (8 PDB entries)

8. Domain d7ceib_: 7cei B: [37134]
   Other proteins in same PDB: d7ceia_
   complexed with zn3

Details for d7ceib_

PDB Entry: 7cei, 2.3 Å

PDB Description: the endonuclease domain of colicin e7 in complex with its inhibitor im7 protein

PDB Compounds: (B:) protein (colicin e7 immunity protein)

SCOP Domain Sequences for d7ceib_:

Sequence; same for both SEQRES and ATOM records:

>d7ceib_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp
krhidih

Timeline for d7ceib_:

• d7ceib_ first appeared (with stable ids) in SCOP 1.55
  
• d7ceib_ appears in SCOP 1.73
  
• d7ceib_ appears in SCOPe 2.01
  
• d7ceib_ appears in the current release, SCOPe 2.08