Lineage for d7ceib_ (7cei B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253179Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 253180Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 253181Family d.4.1.1: HNH-motif [54061] (2 proteins)
  6. 253182Protein DNase domain of colicin E7 [54062] (1 species)
  7. 253183Species Escherichia coli [TaxId:562] [54063] (3 PDB entries)
  8. 253188Domain d7ceib_: 7cei B: [37134]
    Other proteins in same PDB: d7ceia_
    complexed with zn3

Details for d7ceib_

PDB Entry: 7cei (more details), 2.3 Å

PDB Description: the endonuclease domain of colicin e7 in complex with its inhibitor im7 protein

SCOP Domain Sequences for d7ceib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ceib_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli}
rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp
krhidih

SCOP Domain Coordinates for d7ceib_:

Click to download the PDB-style file with coordinates for d7ceib_.
(The format of our PDB-style files is described here.)

Timeline for d7ceib_: