Lineage for d7ceib_ (7cei B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77113Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
  4. 77114Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) (S)
  5. 77115Family d.4.1.1: HNH-motif [54061] (2 proteins)
  6. 77116Protein DNase domain of colicin E7 [54062] (1 species)
  7. 77117Species Escherichia coli [TaxId:562] [54063] (1 PDB entry)
  8. 77118Domain d7ceib_: 7cei B: [37134]
    Other proteins in same PDB: d7ceia_

Details for d7ceib_

PDB Entry: 7cei (more details), 2.3 Å

PDB Description: the endonuclease domain of colicin e7 in complex with its inhibitor im7 protein

SCOP Domain Sequences for d7ceib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ceib_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli}
rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp
krhidih

SCOP Domain Coordinates for d7ceib_:

Click to download the PDB-style file with coordinates for d7ceib_.
(The format of our PDB-style files is described here.)

Timeline for d7ceib_: