SCOPe 2.07: Domain d1euva1: 1euv A:403-621

Lineage for d1euva1 (1euv A:403-621)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Ulp1 protease C-terminal domain [54057] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries)

8. Domain d1euva1: 1euv A:403-621 [37133]
   Other proteins in same PDB: d1euva2, d1euvb_

Details for d1euva1

PDB Entry: 1euv, 1.6 Å

PDB Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.

PDB Compounds: (A:) ulp1 protease

SCOPe Domain Sequences for d1euva1:

Sequence; same for both SEQRES and ATOM records:

>d1euva1 d.3.1.7 (A:403-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmkyie
kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl
kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi
yvcmntlygsadapldfdykdairmrrfiahliltdalk

Timeline for d1euva1:

• d1euva1 first appeared (with stable ids) in SCOP 1.55, called d1euva_
  
• d1euva1 appears in SCOPe 2.06
  
• d1euva1 appears in the current release, SCOPe 2.08