Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
Protein Ulp1 protease C-terminal domain [54057] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries) |
Domain d1euva1: 1euv A:403-621 [37133] Other proteins in same PDB: d1euva2, d1euvb_ |
PDB Entry: 1euv (more details), 1.6 Å
SCOPe Domain Sequences for d1euva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euva1 d.3.1.7 (A:403-621) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmkyie kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi yvcmntlygsadapldfdykdairmrrfiahliltdalk
Timeline for d1euva1: