![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
![]() | Protein Ulp1 protease C-terminal domain [54057] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries) |
![]() | Domain d1euva_: 1euv A: [37133] Other proteins in same PDB: d1euvb_ |
PDB Entry: 1euv (more details), 1.6 Å
SCOPe Domain Sequences for d1euva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euva_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc giyvcmntlygsadapldfdykdairmrrfiahliltdalk
Timeline for d1euva_: