| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (16 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.7: Adenain-like [54054] (5 proteins) Pfam PF02902; Ulp1 protease family |
| Protein Ulp1 protease C-terminal domain [54057] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (1 PDB entry) |
| Domain d1euva_: 1euv A: [37133] Other proteins in same PDB: d1euvb_ |
PDB Entry: 1euv (more details), 1.6 Å
SCOP Domain Sequences for d1euva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euva_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk
Timeline for d1euva_: