SCOP 1.69: Domain d1euva_: 1euv A:

Lineage for d1euva_ (1euv A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (11 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (3 proteins)

6. Protein Ulp1 protease C-terminal domain [54057] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (1 PDB entry)

8. Domain d1euva_: 1euv A: [37133]
   Other proteins in same PDB: d1euvb_

Details for d1euva_

PDB Entry: 1euv, 1.6 Å

PDB Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.

SCOP Domain Sequences for d1euva_:

Sequence; same for both SEQRES and ATOM records:

>d1euva_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk

Timeline for d1euva_:

• d1euva_ first appeared (with stable ids) in SCOP 1.55
  
• d1euva_ appears in SCOP 1.67
  
• d1euva_ appears in SCOP 1.71
  
• d1euva_ appears in the current release, SCOPe 2.08, called d1euva1