Lineage for d1euva_ (1euv A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498098Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 498099Superfamily d.3.1: Cysteine proteinases [54001] (11 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 498389Family d.3.1.7: Adenain-like [54054] (3 proteins)
  6. 498399Protein Ulp1 protease C-terminal domain [54057] (1 species)
  7. 498400Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (1 PDB entry)
  8. 498401Domain d1euva_: 1euv A: [37133]
    Other proteins in same PDB: d1euvb_

Details for d1euva_

PDB Entry: 1euv (more details), 1.6 Å

PDB Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.

SCOP Domain Sequences for d1euva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euva_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk

SCOP Domain Coordinates for d1euva_:

Click to download the PDB-style file with coordinates for d1euva_.
(The format of our PDB-style files is described here.)

Timeline for d1euva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1euvb_