Lineage for d1euva_ (1euv A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.7: Adenoviral protease-like [54054] (2 proteins) Protein Ulp1 protease C-terminal domain [54057] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (1 PDB entry) 
Domain d1euva_: 1euv A: [37133]
Other proteins in same PDB: d1euvb_
Details for d1euva_
PDB Entry: 1euv (more details), 1.6 Å
PDB Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.
SCOP Domain Sequences for d1euva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euva_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk
SCOP Domain Coordinates for d1euva_:
Click to download the PDB-style file with coordinates for d1euva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1euva_:
- d1euva_ appears in SCOP 1.57
- d1euva_ appears in the current release, SCOPe 2.08, called d1euva1
View in 3D
