Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Aspergillus aculeatus [TaxId:690307] [371307] (2 PDB entries) |
Domain d6q8ma_: 6q8m A: [371322] automated match to d3u7ba_ complexed with edo, k, nag |
PDB Entry: 6q8m (more details), 1.42 Å
SCOPe Domain Sequences for d6q8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q8ma_ c.1.8.0 (A:) automated matches {Aspergillus aculeatus [TaxId: 690307]} vgldqaavakglqyfgtatdnpeltdipyvtqlnntadfgqitpgnsmkwdatepsqgtf tftkgdviadlaegngqylrchtlvwynqlpswvtsgtwtnatltaalknhitnvvshyk gkclhwdvvnealnddgtyrtnifyttigeayipiafaaaaaadpdaklfyndynleygg akaasaraivqlvknagakidgvglqahfsvgtvpstsslvsvlqsftalgvevaytead vrillpttattlaqqssdfqalvqscvqttgcvgftiwdwtdkyswvpstfsgygaalpw denlvkkpayngllagmgvtv
Timeline for d6q8ma_: