Lineage for d6q8ma_ (6q8m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832379Species Aspergillus aculeatus [TaxId:690307] [371307] (2 PDB entries)
  8. 2832380Domain d6q8ma_: 6q8m A: [371322]
    automated match to d3u7ba_
    complexed with edo, k, nag

Details for d6q8ma_

PDB Entry: 6q8m (more details), 1.42 Å

PDB Description: gh10 endo-xylanase
PDB Compounds: (A:) Beta-xylanase

SCOPe Domain Sequences for d6q8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q8ma_ c.1.8.0 (A:) automated matches {Aspergillus aculeatus [TaxId: 690307]}
vgldqaavakglqyfgtatdnpeltdipyvtqlnntadfgqitpgnsmkwdatepsqgtf
tftkgdviadlaegngqylrchtlvwynqlpswvtsgtwtnatltaalknhitnvvshyk
gkclhwdvvnealnddgtyrtnifyttigeayipiafaaaaaadpdaklfyndynleygg
akaasaraivqlvknagakidgvglqahfsvgtvpstsslvsvlqsftalgvevaytead
vrillpttattlaqqssdfqalvqscvqttgcvgftiwdwtdkyswvpstfsgygaalpw
denlvkkpayngllagmgvtv

SCOPe Domain Coordinates for d6q8ma_:

Click to download the PDB-style file with coordinates for d6q8ma_.
(The format of our PDB-style files is described here.)

Timeline for d6q8ma_: