SCOP 1.75: Domain d1avpa_: 1avp A:

Lineage for d1avpa_ (1avp A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (5 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Human adenovirus 2 proteinase, adenain [54055] (1 species)

7. Species Mastadenovirus H2 [TaxId:10515] [54056] (2 PDB entries)

8. Domain d1avpa_: 1avp A: [37132]
   complexed with peptide cofactor, chain B

Details for d1avpa_

PDB Entry: 1avp, 2.6 Å

PDB Description: structure of human adenovirus 2 proteinase with its 11 amino acid cofactor

PDB Compounds: (A:) adenoviral proteinase

SCOP Domain Sequences for d1avpa_:

Sequence; same for both SEQRES and ATOM records:

>d1avpa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]}
mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
hspyfrshsaqirsatsfchlknm

Timeline for d1avpa_:

• d1avpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1avpa_ appears in SCOP 1.73
  
• d1avpa_ appears in SCOPe 2.01
  
• d1avpa_ appears in the current release, SCOPe 2.08