Lineage for d1avpa_ (1avp A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76916Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 76917Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 77106Family d.3.1.7: Adenoviral protease-like [54054] (2 proteins)
  6. 77107Protein Human adenovirus 2 proteinase [54055] (1 species)
  7. 77108Species Mastadenovirus H2 [TaxId:10515] [54056] (1 PDB entry)
  8. 77109Domain d1avpa_: 1avp A: [37132]

Details for d1avpa_

PDB Entry: 1avp (more details), 2.6 Å

PDB Description: structure of human adenovirus 2 proteinase with its 11 amino acid cofactor

SCOP Domain Sequences for d1avpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avpa_ d.3.1.7 (A:) Human adenovirus 2 proteinase {Mastadenovirus H2}
mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
hspyfrshsaqirsatsfchlknm

SCOP Domain Coordinates for d1avpa_:

Click to download the PDB-style file with coordinates for d1avpa_.
(The format of our PDB-style files is described here.)

Timeline for d1avpa_: