Lineage for d6pfnd1 (6pfn D:1-239)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585664Species Francisella tularensis [TaxId:177416] [358068] (2 PDB entries)
  8. 2585666Domain d6pfnd1: 6pfn D:1-239 [371300]
    Other proteins in same PDB: d6pfna1, d6pfna2, d6pfna3, d6pfnc1, d6pfnc2, d6pfnc3
    automated match to d2nu8b2
    complexed with act, coa, edo

Details for d6pfnd1

PDB Entry: 6pfn (more details), 1.76 Å

PDB Description: succinyl-coa synthase from francisella tularensis
PDB Compounds: (D:) Succinate--CoA ligase [ADP-forming] subunit beta

SCOPe Domain Sequences for d6pfnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfnd1 d.142.1.0 (D:1-239) automated matches {Francisella tularensis [TaxId: 177416]}
mnlheyqakdllesyglkvqkgivahnpneaaqafdqlggkfavvkaqvhaggrgkaggv
kvvkssqetrevaesligknlvtfqtdaegqpvnsvgvfedvypvtrelylgavvdrssr
kvtfmasteggvdieevahnspekilkvevdplvglqpfqarevafklglegkqindfvk
tmlgaykafiecdfalfeinplavrengeivcvdgkinldsnalyrhpkllalrdksqe

SCOPe Domain Coordinates for d6pfnd1:

Click to download the PDB-style file with coordinates for d6pfnd1.
(The format of our PDB-style files is described here.)

Timeline for d6pfnd1: