Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (38 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [358068] (2 PDB entries) |
Domain d6pfnd1: 6pfn D:1-239 [371300] Other proteins in same PDB: d6pfna1, d6pfna2, d6pfna3, d6pfnc1, d6pfnc2, d6pfnc3 automated match to d2nu8b2 complexed with act, coa, edo |
PDB Entry: 6pfn (more details), 1.76 Å
SCOPe Domain Sequences for d6pfnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pfnd1 d.142.1.0 (D:1-239) automated matches {Francisella tularensis [TaxId: 177416]} mnlheyqakdllesyglkvqkgivahnpneaaqafdqlggkfavvkaqvhaggrgkaggv kvvkssqetrevaesligknlvtfqtdaegqpvnsvgvfedvypvtrelylgavvdrssr kvtfmasteggvdieevahnspekilkvevdplvglqpfqarevafklglegkqindfvk tmlgaykafiecdfalfeinplavrengeivcvdgkinldsnalyrhpkllalrdksqe
Timeline for d6pfnd1: