Lineage for d1cmxa_ (1cmx A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29743Family d.3.1.6: Deubiquitinating enzyme [54050] (1 protein)
  6. 29744Protein Ubiquitin C-terminal hydrolase UCH-l3 [54051] (2 species)
  7. 29747Species Synthetic, based on Saccharomyces cerevisiae sequence [54053] (1 PDB entry)
  8. 29748Domain d1cmxa_: 1cmx A: [37130]
    Other proteins in same PDB: d1cmxb_, d1cmxd_

Details for d1cmxa_

PDB Entry: 1cmx (more details), 2.25 Å

PDB Description: structural basis for the specificity of ubiquitin c-terminal hydrolases

SCOP Domain Sequences for d1cmxa_:

Sequence, based on SEQRES records: (download)

>d1cmxa_ d.3.1.6 (A:) Ubiquitin C-terminal hydrolase UCH-l3 {Synthetic, based on Saccharomyces cerevisiae sequence}
ravvpiesnpevftnfahklglknewayfdiysltepellaflprpvkaivllfpinedr
ksstsqqitssydviwfkqsvknacglyailhslsnnqsllepgsdldnflksqsdtsss
knrfddvttdqfvlnvikenvqtfstgqseapeatadtnlhyityveenggifeldgrnl
sgplylgksdptatdlieqelvrvrvasymenaneedvlnfamlglgpn

Sequence, based on observed residues (ATOM records): (download)

>d1cmxa_ d.3.1.6 (A:) Ubiquitin C-terminal hydrolase UCH-l3 {Synthetic, based on Saccharomyces cerevisiae sequence}
ravvpiesnpevftnfahklglknewayfdiysltepellaflprpvkaivllfpindvi
wfkqsvknacglyailhslsnnqsllepgsdldnflksqsdtsssknrfddvttdqfvln
vikenvqtfstgqseapeatadtnlhyityveenggifeldgrnlsgplylgksdptatd
lieqelvrvrvasymenaneedvlnfamlglgpn

SCOP Domain Coordinates for d1cmxa_:

Click to download the PDB-style file with coordinates for d1cmxa_.
(The format of our PDB-style files is described here.)

Timeline for d1cmxa_: