Lineage for d6pfnc1 (6pfn C:2-122)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455275Species Francisella tularensis [TaxId:177416] [195722] (4 PDB entries)
  8. 2455278Domain d6pfnc1: 6pfn C:2-122 [371291]
    Other proteins in same PDB: d6pfna2, d6pfna3, d6pfnb1, d6pfnc2, d6pfnc3, d6pfnd1
    automated match to d2yv1a1
    complexed with act, coa, edo

Details for d6pfnc1

PDB Entry: 6pfn (more details), 1.76 Å

PDB Description: succinyl-coa synthase from francisella tularensis
PDB Compounds: (C:) Succinate--CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d6pfnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfnc1 c.2.1.0 (C:2-122) automated matches {Francisella tularensis [TaxId: 177416]}
svlvdkntkvlvqgftgkngtfhseqaiaygtnivggvtpgkggtthldrpvfntmaeav
aatgadasviyvpapfvkdsaievidsgvklvviitegvptldmlvvkeylkdkdvrvig
p

SCOPe Domain Coordinates for d6pfnc1:

Click to download the PDB-style file with coordinates for d6pfnc1.
(The format of our PDB-style files is described here.)

Timeline for d6pfnc1: