Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [195722] (4 PDB entries) |
Domain d6pfnc1: 6pfn C:2-122 [371291] Other proteins in same PDB: d6pfna2, d6pfna3, d6pfnb1, d6pfnc2, d6pfnc3, d6pfnd1 automated match to d2yv1a1 complexed with act, coa, edo |
PDB Entry: 6pfn (more details), 1.76 Å
SCOPe Domain Sequences for d6pfnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pfnc1 c.2.1.0 (C:2-122) automated matches {Francisella tularensis [TaxId: 177416]} svlvdkntkvlvqgftgkngtfhseqaiaygtnivggvtpgkggtthldrpvfntmaeav aatgadasviyvpapfvkdsaievidsgvklvviitegvptldmlvvkeylkdkdvrvig p
Timeline for d6pfnc1: