Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
Family b.121.2.0: automated matches [227210] (1 protein) not a true family |
Protein automated matches [226945] (4 species) not a true protein |
Species Enterobacteria phage [TaxId:261665] [371285] (1 PDB entry) |
Domain d6q5ub2: 6q5u B:245-390 [371286] Other proteins in same PDB: d6q5ua1, d6q5ub1, d6q5uc1, d6q5ud1, d6q5ue1, d6q5uf1, d6q5ug1, d6q5uh1, d6q5ui1, d6q5uj1, d6q5uk1, d6q5ul1 automated match to d1hx6a2 |
PDB Entry: 6q5u (more details), 2.75 Å
SCOPe Domain Sequences for d6q5ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q5ub2 b.121.2.0 (B:245-390) automated matches {Enterobacteria phage [TaxId: 261665]} ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp ktvnqnarllmgyeyftsrtelvnag
Timeline for d6q5ub2: