SCOPe 2.08: Domain d6q5ub2: 6q5u B:245-390

Lineage for d6q5ub2 (6q5u B:245-390)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.0: automated matches [227210] (1 protein)
   not a true family

6. Protein automated matches [226945] (4 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:261665] [371285] (1 PDB entry)

8. Domain d6q5ub2: 6q5u B:245-390 [371286]
   Other proteins in same PDB: d6q5ua1, d6q5ub1, d6q5uc1, d6q5ud1, d6q5ue1, d6q5uf1, d6q5ug1, d6q5uh1, d6q5ui1, d6q5uj1, d6q5uk1, d6q5ul1
   automated match to d1hx6a2

Details for d6q5ub2

PDB Entry: 6q5u, 2.75 Å

PDB Description: high resolution electron cryo-microscopy structure of the bacteriophage pr772

PDB Compounds: (B:) Major Capsid Protein (P3)

SCOPe Domain Sequences for d6q5ub2:

Sequence; same for both SEQRES and ATOM records:

>d6q5ub2 b.121.2.0 (B:245-390) automated matches {Enterobacteria phage [TaxId: 261665]}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrtelvnag

Timeline for d6q5ub2:

• d6q5ub2 first appeared in SCOPe 2.07