SCOPe 2.08: Domain d1e2th_: 1e2t H:

Lineage for d1e2th_ (1e2t H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein Arylamine N-acetyltransferase [54048] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry)

8. Domain d1e2th_: 1e2t H: [37128]

Details for d1e2th_

PDB Entry: 1e2t, 2.8 Å

PDB Description: arylamine n-acetyltransferase (nat) from salmonella typhimurium

PDB Compounds: (H:) n-hydroxyarylamine o-acetyltransferase

SCOPe Domain Sequences for d1e2th_:

Sequence; same for both SEQRES and ATOM records:

>d1e2th_ d.3.1.5 (H:) Arylamine N-acetyltransferase {Salmonella typhimurium [TaxId: 90371]}
hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
pslyqllqqqfglgvndvkhgfteaelaavmaaf

Timeline for d1e2th_:

• d1e2th_ first appeared (with stable ids) in SCOP 1.55
  
• d1e2th_ appears in SCOPe 2.07