Lineage for d6pnva2 (6pnv A:163-431)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808379Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) (S)
  5. 2808380Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)
  6. 2808393Protein automated matches [232579] (3 species)
    not a true protein
  7. 2808400Species Salmonella enterica [TaxId:1159899] [371276] (1 PDB entry)
  8. 2808401Domain d6pnva2: 6pnv A:163-431 [371277]
    Other proteins in same PDB: d6pnva1, d6pnva3
    automated match to d4pwza2
    complexed with k, na

Details for d6pnva2

PDB Entry: 6pnv (more details), 1.42 Å

PDB Description: 1.42 angstrom resolution crystal structure of translocation protein tolb from salmonella enterica
PDB Compounds: (A:) Tol-Pal system protein TolB

SCOPe Domain Sequences for d6pnva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pnva2 b.68.4.1 (A:163-431) automated matches {Salmonella enterica [TaxId: 1159899]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgtklafalsktgslnlyvmdlasgqir
qitdgrsnnteptwfpdsqtlaftsdqagrpqvykmninggaaqritwegsqnqdadvss
dgkfmvmvssnngqqhiakqdlvtggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkspawspyl

SCOPe Domain Coordinates for d6pnva2:

Click to download the PDB-style file with coordinates for d6pnva2.
(The format of our PDB-style files is described here.)

Timeline for d6pnva2: