![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) ![]() |
![]() | Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins) |
![]() | Protein automated matches [232579] (3 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:1159899] [371276] (1 PDB entry) |
![]() | Domain d6pnva2: 6pnv A:163-431 [371277] Other proteins in same PDB: d6pnva1, d6pnva3 automated match to d4pwza2 complexed with k, na |
PDB Entry: 6pnv (more details), 1.42 Å
SCOPe Domain Sequences for d6pnva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pnva2 b.68.4.1 (A:163-431) automated matches {Salmonella enterica [TaxId: 1159899]} afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes grsalviqtlangavrqvasfprhngapafspdgtklafalsktgslnlyvmdlasgqir qitdgrsnnteptwfpdsqtlaftsdqagrpqvykmninggaaqritwegsqnqdadvss dgkfmvmvssnngqqhiakqdlvtggvqvlsstfldetpslapngtmviysssqgmgsvl nlvstdgrfkarlpatdgqvkspawspyl
Timeline for d6pnva2: