Lineage for d6pnva1 (6pnv A:24-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489935Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2489949Family c.51.2.0: automated matches [232575] (1 protein)
    not a true family
  6. 2489950Protein automated matches [232576] (4 species)
    not a true protein
  7. 2489960Species Salmonella enterica [TaxId:1159899] [371274] (1 PDB entry)
  8. 2489961Domain d6pnva1: 6pnv A:24-162 [371275]
    Other proteins in same PDB: d6pnva2, d6pnva3
    automated match to d4pwza1
    complexed with k, na

Details for d6pnva1

PDB Entry: 6pnv (more details), 1.42 Å

PDB Description: 1.42 angstrom resolution crystal structure of translocation protein tolb from salmonella enterica
PDB Compounds: (A:) Tol-Pal system protein TolB

SCOPe Domain Sequences for d6pnva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pnva1 c.51.2.0 (A:24-162) automated matches {Salmonella enterica [TaxId: 1159899]}
vrieitqgvdsarpigvvpfkwagpgaapediggivaadlrnsgkfnpldrsrlpqqpat
aqevqptawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlr
yaghtasdevfekltgikg

SCOPe Domain Coordinates for d6pnva1:

Click to download the PDB-style file with coordinates for d6pnva1.
(The format of our PDB-style files is described here.)

Timeline for d6pnva1: