SCOP 1.65: Domain d1e2tc_: 1e2t C:

Lineage for d1e2tc_ (1e2t C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (9 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
   fold similar to that of the factor XIII catalytic domain

6. Protein Arylamine N-acetyltransferase [54048] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry)

8. Domain d1e2tc_: 1e2t C: [37123]

Details for d1e2tc_

PDB Entry: 1e2t, 2.8 Å

PDB Description: arylamine n-acetyltransferase (nat) from salmonella typhimurium

SCOP Domain Sequences for d1e2tc_:

Sequence; same for both SEQRES and ATOM records:

>d1e2tc_ d.3.1.5 (C:) Arylamine N-acetyltransferase {Salmonella typhimurium}
hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
pslyqllqqqfglgvndvkhgfteaelaavmaaf

Timeline for d1e2tc_:

• d1e2tc_ first appeared (with stable ids) in SCOP 1.55
  
• d1e2tc_ appears in SCOP 1.63
  
• d1e2tc_ appears in SCOP 1.67
  
• d1e2tc_ appears in the current release, SCOPe 2.08