Lineage for d6o5nd2 (6o5n D:244-431)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959756Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)
  8. 2959943Domain d6o5nd2: 6o5n D:244-431 [371226]
    Other proteins in same PDB: d6o5na1, d6o5nb1, d6o5nc1, d6o5nd1, d6o5ne_, d6o5nf1, d6o5nf2, d6o5nf3
    automated match to d3rycd2
    complexed with ca, gdp, gtp, mes, mg, qw9

Details for d6o5nd2

PDB Entry: 6o5n (more details), 3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 10ab
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6o5nd2:

Sequence, based on SEQRES records: (download)

>d6o5nd2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d6o5nd2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d6o5nd2:

Click to download the PDB-style file with coordinates for d6o5nd2.
(The format of our PDB-style files is described here.)

Timeline for d6o5nd2: