Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d6oyhf_: 6oyh F: [371224] Other proteins in same PDB: d6oyhe2, d6oyhh2 automated match to d4w81a_ complexed with nk4 |
PDB Entry: 6oyh (more details), 2.95 Å
SCOPe Domain Sequences for d6oyhf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oyhf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]} dvqlqesggglvqtggsltlscatsgrsfslyamawfrqapgkerefvagvsrrgntaya davkgrftisrdnaantvylqmtslkpedtavyfcaafrvavttytsqqaneynywgqgt qvtvs
Timeline for d6oyhf_: