Lineage for d6ovic_ (6ovi C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836426Species Legionella pneumophila [TaxId:446] [371184] (1 PDB entry)
  8. 2836429Domain d6ovic_: 6ovi C: [371199]
    automated match to d1mxsa_
    complexed with edo, pvo, so4

Details for d6ovic_

PDB Entry: 6ovi (more details), 1.6 Å

PDB Description: crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
PDB Compounds: (C:) Keto-deoxy-phosphogluconate aldolase

SCOPe Domain Sequences for d6ovic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ovic_ c.1.10.0 (C:) automated matches {Legionella pneumophila [TaxId: 446]}
fsewktqpgavfaaspvipvivikeledalplaealfaggihvlevtlrtpvaikalell
intfpdeligagtvitpgqfhdvvaagarfaispgqtrelliagqkseiplipgvasvse
lmeglgmgynhfkffpaaaaggipmlkaisgvfpqvkfcptgginsknyeeylclpnvac
vggswivpeeaiknhnwslitelcmavss

SCOPe Domain Coordinates for d6ovic_:

Click to download the PDB-style file with coordinates for d6ovic_.
(The format of our PDB-style files is described here.)

Timeline for d6ovic_: