SCOPe 2.08: Domain d6o60d2: 6o60 D:79-160

Lineage for d6o60d2 (6o60 D:79-160)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d6o60d2: 6o60 D:79-160 [371194]
   Other proteins in same PDB: d6o60b_, d6o60d1
   automated match to d5k35b2
   complexed with zn

Details for d6o60d2

PDB Entry: 6o60, 2.5 Å

PDB Description: crystal structure of ggtase3-fbxl2-skp1 complex

PDB Compounds: (D:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6o60d2:

Sequence; same for both SEQRES and ATOM records:

>d6o60d2 a.157.1.1 (D:79-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndfteeeeaqvrkenqwc

Timeline for d6o60d2:

• d6o60d2 first appeared in SCOPe 2.07