SCOPe 2.08: Domain d6o60d1: 6o60 D:2-67

Lineage for d6o60d1 (6o60 D:2-67)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d6o60d1: 6o60 D:2-67 [371193]
   Other proteins in same PDB: d6o60b_, d6o60d2
   automated match to d5k35b1
   complexed with zn

Details for d6o60d1

PDB Entry: 6o60, 2.5 Å

PDB Description: crystal structure of ggtase3-fbxl2-skp1 complex

PDB Compounds: (D:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6o60d1:

Sequence; same for both SEQRES and ATOM records:

>d6o60d1 d.42.1.0 (D:2-67) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthhkd

Timeline for d6o60d1:

• d6o60d1 first appeared in SCOPe 2.07