Lineage for d1ggyb4 (1ggy B:191-508)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927111Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 2927117Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 2927118Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (9 PDB entries)
    Coagulation factor XIII
  8. 2927132Domain d1ggyb4: 1ggy B:191-508 [37118]
    Other proteins in same PDB: d1ggya1, d1ggya2, d1ggya3, d1ggyb1, d1ggyb2, d1ggyb3
    complexed with yb

Details for d1ggyb4

PDB Entry: 1ggy (more details), 2.5 Å

PDB Description: human factor xiii with ytterbium bound in the ion site
PDB Compounds: (B:) protein (coagulation factor xiii)

SCOPe Domain Sequences for d1ggyb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggyb4 d.3.1.4 (B:191-508) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplnt

SCOPe Domain Coordinates for d1ggyb4:

Click to download the PDB-style file with coordinates for d1ggyb4.
(The format of our PDB-style files is described here.)

Timeline for d1ggyb4: