SCOPe 2.07: Domain d6ovzb_: 6ovz B:

Lineage for d6ovzb_ (6ovz B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226145] (21 PDB entries)

8. Domain d6ovzb_: 6ovz B: [371174]
   automated match to d4eyba_
   complexed with ca, fmt, n9j, n9m, zn

Details for d6ovzb_

PDB Entry: 6ovz, 2.02 Å

PDB Description: crystal structure of the new delhi metallo-beta-lactamase-1 adduct with a lysine-targeted affinity label

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6ovzb_:

Sequence; same for both SEQRES and ATOM records:

>d6ovzb_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

Timeline for d6ovzb_:

• d6ovzb_ is new in SCOPe 2.07-stable
  
• d6ovzb_ appears in the current release, SCOPe 2.08