SCOPe 2.07: Domain d6op5e2: 6op5 E:237-391

Lineage for d6op5e2 (6op5 E:237-391)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.0: automated matches [196908] (1 protein)
not a true family
Protein automated matches [196909] (81 species)
not a true protein
Species Piper methysticum [TaxId:130404] [350817] (3 PDB entries)
Domain d6op5e2: 6op5 E:237-391 [371157]
automated match to d3wd8a2
complexed with wca

Details for d6op5e2

PDB Entry: 6op5 (more details), 2.7 Å

PDB Description: crystal structure of piper methysticum styrylpyrone synthase 1 in complex with p-coumaroyl-coa

PDB Compounds: (E:) Styrylpyrone synthase 1

SCOPe Domain Sequences for d6op5e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6op5e2 c.95.1.0 (E:237-391) automated matches {Piper methysticum [TaxId: 130404]}
lfqivsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdw
nsifwiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsme
egktttgegfdwgvlfgfgpgftvetvvlhsmpip

SCOPe Domain Coordinates for d6op5e2:

Click to download the PDB-style file with coordinates for d6op5e2.
(The format of our PDB-style files is described here.)

Timeline for d6op5e2: