Lineage for d1ggua4 (1ggu A:191-508)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29715Family d.3.1.4: Transglutaminase [54044] (1 protein)
  6. 29716Protein Coagulation factor XIII, catalytic domain [54045] (1 species)
  7. 29717Species Human (Homo sapiens), blood [TaxId:9606] [54046] (7 PDB entries)
  8. 29722Domain d1ggua4: 1ggu A:191-508 [37115]
    Other proteins in same PDB: d1ggua1, d1ggua2, d1ggua3, d1ggub1, d1ggub2, d1ggub3

Details for d1ggua4

PDB Entry: 1ggu (more details), 2.1 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1ggua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggua4 d.3.1.4 (A:191-508) Coagulation factor XIII, catalytic domain {Human (Homo sapiens), blood}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplnt

SCOP Domain Coordinates for d1ggua4:

Click to download the PDB-style file with coordinates for d1ggua4.
(The format of our PDB-style files is described here.)

Timeline for d1ggua4: