Lineage for d6ojvd_ (6ojv D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578916Species Human (Homo sapiens) [TaxId:9606] [55840] (42 PDB entries)
  8. 2578985Domain d6ojvd_: 6ojv D: [371148]
    automated match to d1hzwa_
    complexed with 2xb, ump

Details for d6ojvd_

PDB Entry: 6ojv (more details), 2.59 Å

PDB Description: crystal structure of human thymidylate synthase delta(7-29) in complex with dump and 2-amino-4-oxo-4,7-dihydro-pyrrolo[2,3-d]pyrimidine- methyl-phenyl-l-glutamic acid
PDB Compounds: (D:) Thymidylate synthase,Thymidylate synthase

SCOPe Domain Sequences for d6ojvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ojvd_ d.117.1.1 (D:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
selqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvleel
lwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyrd
mesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnsel
scqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplkiq
lqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d6ojvd_:

Click to download the PDB-style file with coordinates for d6ojvd_.
(The format of our PDB-style files is described here.)

Timeline for d6ojvd_:

  • d6ojvd_ is new in SCOPe 2.07-stable
  • d6ojvd_ appears in the current release, SCOPe 2.08, called d6ojvd1