SCOPe 2.07: Domain d6ogxd2: 6ogx D:107-213

Lineage for d6ogxd2 (6ogx D:107-213)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d6ogxd2: 6ogx D:107-213 [371145]
Other proteins in same PDB: d6ogxd1, d6ogxg1, d6ogxg2, d6ogxg3, d6ogxl1
automated match to d1dn0a2
complexed with nag

Details for d6ogxd2

PDB Entry: 6ogx (more details), 2.77 Å

PDB Description: ternary complex of ox40r (tnfrsf4) bound to fab1 and fab2

PDB Compounds: (D:) Fab1 Light Chain

SCOPe Domain Sequences for d6ogxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ogxd2 b.1.1.2 (D:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6ogxd2:

Click to download the PDB-style file with coordinates for d6ogxd2.
(The format of our PDB-style files is described here.)

Timeline for d6ogxd2: