Lineage for d1evub4 (1evu B:191-508)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634503Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 1634509Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 1634510Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (8 PDB entries)
    Coagulation factor XIII
  8. 1634516Domain d1evub4: 1evu B:191-508 [37114]
    Other proteins in same PDB: d1evua1, d1evua2, d1evua3, d1evub1, d1evub2, d1evub3
    complexed with ca, pgo

Details for d1evub4

PDB Entry: 1evu (more details), 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site
PDB Compounds: (B:) coagulation factor xiii

SCOPe Domain Sequences for d1evub4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evub4 d.3.1.4 (B:191-508) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplnt

SCOPe Domain Coordinates for d1evub4:

Click to download the PDB-style file with coordinates for d1evub4.
(The format of our PDB-style files is described here.)

Timeline for d1evub4: