Lineage for d1evua4 (1evu A:191-508)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399388Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 1399394Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 1399395Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (8 PDB entries)
    Coagulation factor XIII
  8. 1399400Domain d1evua4: 1evu A:191-508 [37113]
    Other proteins in same PDB: d1evua1, d1evua2, d1evua3, d1evub1, d1evub2, d1evub3
    complexed with ca, pgo

Details for d1evua4

PDB Entry: 1evu (more details), 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site
PDB Compounds: (A:) coagulation factor xiii

SCOPe Domain Sequences for d1evua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evua4 d.3.1.4 (A:191-508) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplnt

SCOPe Domain Coordinates for d1evua4:

Click to download the PDB-style file with coordinates for d1evua4.
(The format of our PDB-style files is described here.)

Timeline for d1evua4: