![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Transglutaminase catalytic domain [54045] (4 species) |
![]() | Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (9 PDB entries) Coagulation factor XIII |
![]() | Domain d1evua4: 1evu A:191-508 [37113] Other proteins in same PDB: d1evua1, d1evua2, d1evua3, d1evub1, d1evub2, d1evub3 complexed with ca, pgo |
PDB Entry: 1evu (more details), 2.01 Å
SCOPe Domain Sequences for d1evua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evua4 d.3.1.4 (A:191-508) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee rlaletalmygakkplnt
Timeline for d1evua4:
![]() Domains from other chains: (mouse over for more information) d1evub1, d1evub2, d1evub3, d1evub4 |