Lineage for d1ggta4 (1ggt A:191-515)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155058Family d.3.1.4: Transglutaminase core [54044] (3 protein domains)
  6. 2155064Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 2155065Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (9 PDB entries)
    Coagulation factor XIII
  8. 2155082Domain d1ggta4: 1ggt A:191-515 [37111]
    Other proteins in same PDB: d1ggta1, d1ggta2, d1ggta3, d1ggtb1, d1ggtb2, d1ggtb3

Details for d1ggta4

PDB Entry: 1ggt (more details), 2.65 Å

PDB Description: three-dimensional structure of a transglutaminase: human blood coagulation factor xiii
PDB Compounds: (A:) coagulation factor xiii

SCOPe Domain Sequences for d1ggta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggta4 d.3.1.4 (A:191-515) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntegvmksr

SCOPe Domain Coordinates for d1ggta4:

Click to download the PDB-style file with coordinates for d1ggta4.
(The format of our PDB-style files is described here.)

Timeline for d1ggta4: