Lineage for d6ogxg2 (6ogx G:83-142)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639462Protein Tumor necrosis factor receptor superfamily member 4, OX40L receptor [144119] (1 species)
  7. 2639463Species Human (Homo sapiens) [TaxId:9606] [144120] (3 PDB entries)
    Uniprot P43489 143-168! Uniprot P43489 29-82! Uniprot P43489 83-142
  8. 2639474Domain d6ogxg2: 6ogx G:83-142 [371109]
    Other proteins in same PDB: d6ogxd1, d6ogxd2, d6ogxl1, d6ogxl2
    automated match to d2heyr1
    complexed with nag

Details for d6ogxg2

PDB Entry: 6ogx (more details), 2.77 Å

PDB Description: ternary complex of ox40r (tnfrsf4) bound to fab1 and fab2
PDB Compounds: (G:) Tumor necrosis factor receptor superfamily member 4

SCOPe Domain Sequences for d6ogxg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ogxg2 g.24.1.1 (G:83-142) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]}
pctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqack

SCOPe Domain Coordinates for d6ogxg2:

Click to download the PDB-style file with coordinates for d6ogxg2.
(The format of our PDB-style files is described here.)

Timeline for d6ogxg2: