SCOPe 2.08: Domain d6o5nf1: 6o5n F:1-76

Lineage for d6o5nf1 (6o5n F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d6o5nf1: 6o5n F:1-76 [371090]
   Other proteins in same PDB: d6o5na1, d6o5na2, d6o5nb1, d6o5nb2, d6o5nc1, d6o5nc2, d6o5nd1, d6o5nd2, d6o5ne_, d6o5nf2, d6o5nf3
   automated match to d3tiia1
   complexed with ca, gdp, gtp, mes, mg, qw9

Details for d6o5nf1

PDB Entry: 6o5n, 3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 10ab

PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d6o5nf1:

Sequence; same for both SEQRES and ATOM records:

>d6o5nf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d6o5nf1:

• d6o5nf1 first appeared in SCOPe 2.07