![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Transglutaminase catalytic domain [54045] (4 species) |
![]() | Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (9 PDB entries) Coagulation factor XIII |
![]() | Domain d1f13b4: 1f13 B:191-515 [37108] Other proteins in same PDB: d1f13a1, d1f13a2, d1f13a3, d1f13b1, d1f13b2, d1f13b3 |
PDB Entry: 1f13 (more details), 2.1 Å
SCOPe Domain Sequences for d1f13b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f13b4 d.3.1.4 (B:191-515) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee rlaletalmygakkplntegvmksr
Timeline for d1f13b4:
![]() Domains from other chains: (mouse over for more information) d1f13a1, d1f13a2, d1f13a3, d1f13a4 |