| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [353877] (8 PDB entries) |
| Domain d6o5ne_: 6o5n E: [371075] Other proteins in same PDB: d6o5na1, d6o5na2, d6o5nb1, d6o5nb2, d6o5nc1, d6o5nc2, d6o5nd1, d6o5nd2, d6o5nf1, d6o5nf2, d6o5nf3 automated match to d4i55e_ complexed with ca, gdp, gtp, mes, mg, qw9 |
PDB Entry: 6o5n (more details), 3 Å
SCOPe Domain Sequences for d6o5ne_:
Sequence, based on SEQRES records: (download)
>d6o5ne_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke
>d6o5ne_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e
Timeline for d6o5ne_: