SCOPe 2.08: Domain d6o5nc2: 6o5n C:246-440

Lineage for d6o5nc2 (6o5n C:246-440)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d6o5nc2: 6o5n C:246-440 [371074]
Other proteins in same PDB: d6o5na1, d6o5nb1, d6o5nc1, d6o5nd1, d6o5ne_, d6o5nf1, d6o5nf2, d6o5nf3
automated match to d4i50a2
complexed with ca, gdp, gtp, mes, mg, qw9

Details for d6o5nc2

PDB Entry: 6o5n (more details), 3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 10ab

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6o5nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o5nc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d6o5nc2:

Click to download the PDB-style file with coordinates for d6o5nc2.
(The format of our PDB-style files is described here.)

Timeline for d6o5nc2: