SCOPe 2.07: Domain d6o5nb1: 6o5n B:2-243

Lineage for d6o5nb1 (6o5n B:2-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d6o5nb1: 6o5n B:2-243 [371039]
   Other proteins in same PDB: d6o5na2, d6o5nb2, d6o5nc2, d6o5nd2, d6o5ne_, d6o5nf1, d6o5nf2, d6o5nf3
   automated match to d4drxb1
   complexed with ca, gdp, gtp, mes, mg, qw9

Details for d6o5nb1

PDB Entry: 6o5n, 3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 10ab

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6o5nb1:

Sequence; same for both SEQRES and ATOM records:

>d6o5nb1 c.32.1.1 (B:2-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d6o5nb1:

• d6o5nb1 is new in SCOPe 2.07-stable
  
• d6o5nb1 appears in the current release, SCOPe 2.08