Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.17: Spermidine synthase [69557] (3 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
Protein automated matches [190432] (6 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [370997] (1 PDB entry) |
Domain d6o64g_: 6o64 G: [370998] automated match to d1xj5b_ complexed with act, edo, fmt, mli, peg |
PDB Entry: 6o64 (more details), 2 Å
SCOPe Domain Sequences for d6o64g_:
Sequence, based on SEQRES records: (download)
>d6o64g_ c.66.1.17 (G:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} epscmssiipgwfseispmwpgeahslkvekilfqgksdyqdvivfqsatygkvlvldgv iqlterdecayqemithlplcsisnpkkvlvigggdggvlrevarhssveqidiceidkm vvdvakqyfpnvavgyedprvnliigdgvaflknaaegtydavivdssdpigpakelfek pffesvnralrpggvvctqaeslwlhmdiiedivsncrdifkgsvnyawtsvptypsgvi gfmlcssegpqvdfkkpvslidtdessikshcplkyynaeihsaafclpsfakkvids
>d6o64g_ c.66.1.17 (G:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} epscmssiipgwfseispmwpgeahslkvekilfqgksdyqdvivfqsatygkvlvldgv iqlterdecayqemithlplcsisnpkkvlvigggdggvlrevarhssveqidiceidkm vvdvakqyfpnvavgyedprvnliigdgvaflknaaegtydavivdssdpigpakelfek pffesvnralrpggvvctqaeslwlhmdiiedivsncrdifkgsvnyawtsvptypsgvi gfmlcssegpqvdfkkpvslicplkyynaeihsaafclpsfakkvids
Timeline for d6o64g_: