Lineage for d6o11a_ (6o11 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895911Protein NifS-like protein/selenocysteine lyase [53412] (5 species)
  7. 2895923Species Escherichia coli [TaxId:83333] [362244] (10 PDB entries)
  8. 2895926Domain d6o11a_: 6o11 A: [370943]
    automated match to d1jf9a_
    complexed with c6p, cl

Details for d6o11a_

PDB Entry: 6o11 (more details), 1.84 Å

PDB Description: e. coli cysteine desulfurase sufs c364a with a cys-aldimine intermediate
PDB Compounds: (A:) Cysteine desulfurase

SCOPe Domain Sequences for d6o11a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o11a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 83333]}
mifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgiht
lsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisq
mehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgte
nplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvke
allqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalgln
niaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrt
ghhaamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOPe Domain Coordinates for d6o11a_:

Click to download the PDB-style file with coordinates for d6o11a_.
(The format of our PDB-style files is described here.)

Timeline for d6o11a_: