Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (25 species) not a true protein |
Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries) |
Domain d6nqjc1: 6nqj C:3-223 [370939] Other proteins in same PDB: d6nqja2, d6nqjb2, d6nqjc2, d6nqjc3 automated match to d3srya_ mutant |
PDB Entry: 6nqj (more details), 2 Å
SCOPe Domain Sequences for d6nqjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nqjc1 d.22.1.0 (C:3-223) automated matches {Echinophyllia sp. [TaxId: 301887]} vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakkv vqlpdyhfvdhhieikshdkdysnvnlhehaeahsglprqa
Timeline for d6nqjc1: